PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 291aa    MW: 31670.6 Da    PI: 10.1835
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58682549PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.33.7e-13114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
        Lsa018779 114 PWSEDEHRLFLTGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKY 158
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.642107163IPR017930Myb domain
SuperFamilySSF466896.88E-17108164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17110162IPR006447Myb domain, plants
SMARTSM007177.3E-9111161IPR001005SANT/Myb domain
PfamPF002496.4E-11114158IPR001005SANT/Myb domain
CDDcd001671.39E-9114159No hitNo description
Gene3DG3DSA:1.10.10.607.3E-10114157IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTS YNRGNVNSTI LIGGGGGGGL RLFGVQLDTP HSMVIKKCLS  60
MDCLASSSPL QASTSHSPSS SLSSSRVSAS DLKSMSLGYA SDGLRAQERK KGFPWSEDEH  120
RLFLTGLEKL GKGDWRGISR NYVTTRTPTQ VASHAQKYFL RQASLVKKKR RSSLFDLVRG  180
NNKKNVVANQ ENSYNMSRTN SFDEGHQDRS NNISLIDFSS LKQENVYYNP TVKSYETTSM  240
CSHVHASPCG TIGSKSGTLD LELTLAAPKP VENNKSSATT SLQIGPIIRV I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166170KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012873.12e-76Myb-like transcription factor family protein, putative
TrEMBLA0A103XNT41e-117A0A103XNT4_CYNCS; Homeodomain-like protein
STRINGPGSC0003DMT4000009022e-68(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-51MYB_related family protein